Biochemical Reagents
Bachem Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH
Fmoc-Glu(OtBu)-Ser(Psi(Me,Me)pro)-OH, 909115-33-9, C30H36N2O8, Mr 552.62, 5g.
Enzo Life Sciences Orexin A (human, bovine, rat, mouse) (1mg)
Food intake modulator. Hypothalamic neuropeptide that stimulates food intake in rats with impressive potency. Binds specifically to the OX1 receptor. Formula: C152H243N47O44S4. MW: 3561.2. Purity: ≥98% (HPLC). Formulation: Lyophilized. Peptide content: 70-90%. Solubility: Soluble in DMSO; can be diluted with buffers or distilled water. Long Term Storage: -20°C.
Biolegend Human β-Amyloid Peptide (1-40)
Human β-Amyloid Peptide (1-40) Reactivity: Human; Apps: Direct ELISA; Size: 500 ug
Medchemexpress LLC HY-P0035 25mg Medchemexpress, Insulin (human) CAS:11061-68-0 Purity:>98%
Medchemexpress, HY-P0035 25mg Insulin (human) CAS:11061-68-0 Insulin (human) is a polypeptide hormone that regulates the level of glucose. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
CPC Scientific H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH (trifluoroacetate salt) 0.5MG
ONE-LETTER SEQUENCE: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIAMOLECULAR FORMULA: C199H307N53O59S1MOLECULAR WEIGHT:4418STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [107761-42-2], RESEARCH AREA: Alzheimer's DiseaseREFERENCES: E. Paradis et al., J. Neurosci., 16, 7533 (1996); J. Murrell et al., Science, 254, 97 (1991); D. Goldgabber et al., Science, 235, 877 (1987)
CPC Scientific Biotin-Asp-Glu-Val-Asp-CHO 1MG
This biotinylated apopain inhibitor has successfully been used for the affinity purification, on a streptavidin-agarose column, of caspase-3 (apopain); the enzyme that cleaves the poly(ADP-ribose) polymerase (PARP). This inhibitor showed an inhibitory actONE-LETTER SEQUENCE: Biotin-DEVD-CHOMOLECULAR FORMULA: C28H42N6O12S1MOLECULAR WEIGHT:686.7STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [178603-73-1], RESEARCH AREA: ApoptosisREFERENCES: D.W. Nicholson et al., Nature, 376, 37 (1995)
CPC Scientific Ac-Ile-Glu-Pro-Asp-pNA 5MG
Caspase substrate that contains the granzyme B cleavage site. It is additionally proposed as a potential granzyme B target and the optimal P4-P1 substrate sequence for granzyme B.ONE-LETTER SEQUENCE: Ac-IEPD-pNAMOLECULAR FORMULA: C28H38N6O11MOLECULAR WEIGHT:634.7STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [216757-29-8], SYNONYMS: Ac-IEPD-pNARESEARCH AREA: ApoptosisREFERENCES: J.L. Harris et al., J. Biol. Chem., 273, 27364 (1998)
CPC Scientific H-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Met-Leu-Glu-Met-Ala-Lys-Ala-Glu-Gln-Glu-Ala-Glu-Gln-Ala-Ala-Leu-Asn-Arg-Leu-Leu-Leu-Glu-Glu-Ala-NH2 1MG
CRF antagonist, lyophilized solid that acts as a potent antagonist to CRF receptors to block the behavioral and physiological responses to a stressor when administered in the CNS.ONE-LETTER SEQUENCE: DLTFHLLREMLEMAKAEQEAEQAALNRLLLEEA-NH2MOLECULAR FORMULA: C166H274N46O53S2MOLECULAR WEIGHT:3826.41STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [99658-03-4], SYNONYMS: α-Helical CRF (9-41)RESEARCH AREA: HormonalREFERENCES: J. Rivier et al., Science, 224, 889 (1984)
CPC Scientific H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-OH (trifluoroacetate salt) 0.5MG
Prodynorphin (209-225). Opioid receptor agonist.ONE-LETTER SEQUENCE: YGGFLRRIRPKLKWDNQMOLECULAR FORMULA: C99H155N31O23MOLECULAR WEIGHT:2147.52STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [80448-90-4], SYNONYMS: Dynorphin A, Prodynorphin (209-225) (porcine), Prodynorphin (207-223) (human)RESEARCH AREA: PainREFERENCES: A. Goldstein et al., PNAS, 78, 7219 (1981); S. Tachibana et al., Nature, 295, 339 (1982)
CPC Scientific H-Tyr-DPen-Gly-Phe-DPen-OH (trifluoroacetate salt) 5MG
Peptide that performs direct antinociceptive actions via the delta1-opioid receptor, while modulatory via the delta2-opioid receptor.SEQUENCE: H-Tyr-DPen-Gly-Phe-DPen-OH (trifluoroacetate salt)(DPen2 and DPen5 bridge)ONE-LETTER SEQUENCE: Y-DPen-GF-DPen(DPen2&DPen5 bridge)MOLECULAR FORMULA: C30H39N5O7S2MOLECULAR WEIGHT: 645.8STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [88373-73-3]SYNONYMS: RESEARCH AREA: painREFERENCES:H.I. Mosberg et al., PNAS, 80, 5871 (1983)SKU(s): ENKP-001A, ENKP-001B
CPC Scientific H-Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-NH2 (trifluoroacetate salt) 5MG
This agonist of nociceptin (H-3036) is the smallest peptide maintaining the same efficacy and potency as the natural peptide. The amidation protects it from degradation by proteases.ONE-LETTER SEQUENCE: FGGFTGARKSARK-NH2MOLECULAR FORMULA: C61H100N22O15MOLECULAR WEIGHT:1381.6STORAGE CONDITIONS: -20 5C, CAS REGISTRY NUMBER: [178064-02-3], RESEARCH AREA: NeuropeptidesREFERENCES: G.Calo et al., Can. J. Physiol. Pharmacol., 75, 713 (1997); R.Guerrini et al., J. Med. Chem., 40, 1789 (1997)
Biotium Renal Cell Carcinoma (Carbonic Anhydrase IX)(66.4.C2), CF647 conjugate, 0.1mg/mL
Carbonic anhydrase IX (carbonic anhydrase 9) is one of several carbolic anhydrases that vary in tissue distribution and localization. Carbonic anhydrases catalyze the interconversion of carbon dioxide and water into carbonic acid and bicarbonate and are found in all mammalian tissues. Carbonic anhydrase IX is a transmembrane protein that is not expressed in most healthy tissues, but is expressed in most renal cell carcinomas.Primary antibodies are available purified, or with a selection of fluorescent CF Dyes and other labels. CF Dyes offer exceptional brightness and photostability. Note: Conjugates of blue fluorescent dyes like CF405S and CF405M are not recommended for detecting low abundance targets, because blue dyes have lower fluorescence and can give higher non-specific background than other dye colors.
Bachem Boc-Glu-Lys-Lys-AMC
Boc-Glu-Lys-Lys-AMC Acetate, 73554-85-5, C32H48N6O9, Mr 660.77, 100mg. Boc-EKK-AMC, sensitive fluorogenic substrate for urokinase-activated plasmin.
Medchemexpress LLC HY-P1490 5mg Medchemexpress, Bradykinin (2-9) CAS:16875-11-9 Purity:>98%
Medchemexpress, HY-P1490 5mg Bradykinin (2-9) CAS:16875-11-9 Bradykinin (2-9) is an amino-truncated Bradykinin peptide. Bradykinin (2-9) is a metabolite of Bradykinin, cleaved by Aminopeptidase P. Purity:>98% Medchemexpress has over 10000 novel life-science reagents, reference compounds, APIs and natural compounds for laboratory and scientific use. Other quantity can also be offered.
Cayman Chemical 8 9-EET-d11 methyl ester 50ug
An internal standard for the quantification of 8(9)-EET methyl ester by GC- or LC-MS